PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN44516.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 600aa    MW: 64727 Da    PI: 8.302
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN44516.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.92e-093944311954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  KHN44516.1 394 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 431
                 664559******************************88 PP

2BELL92.63.8e-302713251872
        BELL  18 eVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 +Vd+rY++y+eq+++v+++F++v+g g+a pYt+lA+ka+SrhFrcLkdai+ q+
  KHN44516.1 271 KVDRRYSHYCEQMHMVVNAFDMVMGFGAAVPYTALAQKAMSRHFRCLKDAITAQL 325
                 7***************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.6E-65195323IPR006563POX domain
PfamPF075264.6E-40201322IPR006563POX domain
PROSITE profilePS5007112.568372435IPR001356Homeobox domain
CDDcd000864.03E-13375436No hitNo description
SMARTSM003892.0E-9375439IPR001356Homeobox domain
SuperFamilySSF466894.28E-17376442IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28378441IPR009057Homeodomain-like
PfamPF059202.9E-18392431IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 600 aa     Download sequence    Send to blast
MLSNLGPLGD SKNHHHHGSV NSRDSSSSSI VQNQHHHHHN HQHHQMSSIN ADSAAAMQLF  60
LMNPQTTRSP SPPPPPPPPP SSTLHMLLPT FPPGSGGSFS QFTWLPDTTQ EGGGPSTEGP  120
GHGQGLSLSL SSSLEAAKAE ELRMGNSGFL YYNQASGGPS SYKSTLGGHH HQALLAQTHQ  180
GHVGFGAASS STSSLGVVNA LRNSKYAKAA QELLEEFCSV GRGQFKKNKF NRQLSNPSSN  240
LRGSGGGASS SSSKDVPPLS AADRIEHQRR KVDRRYSHYC EQMHMVVNAF DMVMGFGAAV  300
PYTALAQKAM SRHFRCLKDA ITAQLKHSCE VLGEKDGAGN SGLTKGETPR LKMLEQSLRQ  360
QRAFHQMGMM EQEAWRPQRG LPERSVNILR AWLFEHFLHP YPSDADKHLL ARQTGLSRNQ  420
VSNWFINARV RLWKPMVEDM YQQELKEAEG AEEEREGNQS SSNNSGHQLA QTPTPSTTAS  480
TATAPPPPTT TPPTGKRSDS ESDPSLAPIN NTTSTAAMTV TASEVTQLSE LPRTMVADES  540
CRHGSLVATE FGTASAASEI GSTLIRFGTT AGDVSLTLGL RHAGNMPEKT PFSVRDFGGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A7e-17381438158Homeobox protein Meis1
4xrs_B7e-17381438158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006599397.10.0PREDICTED: BEL1-like homeodomain protein 4
RefseqXP_014624496.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ9SW801e-154BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLA0A0B2SCP20.0A0A0B2SCP2_GLYSO; BEL1-like homeodomain protein 2
STRINGGLYMA16G25770.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35243257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-137BEL1-like homeodomain 4
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]